PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy019090
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 541aa    MW: 60744.6 Da    PI: 6.2582
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59524571PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4562.4e-1391715411374
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNq 100
                l+++L+ cA+a++++dl +aq+l+ +l++++s +g+p+qRl ay++e+L arl++s+s++y+al+++e +   s+e l+++++++ev+P++kf+++ aN 
  Ahy019090 171 LKHVLVVCAKAIAENDLLMAQRLMDELRQMVSVSGEPIQRLGAYMLEGLVARLSSSGSSIYRALRCKEPE---SAELLSYMHILYEVCPYFKFGYMSANG 267
                6899*****************************************************************9...9************************** PP

       GRAS 101 aIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp 198
                aI ea++ e+rvHiiDf+isqG QW++L+qa+a+Rp+gpp++RiTg+++++s   +   l+ +g+rL+k+Ae+++vpfef++ +a +  d++l++L v+p
  Ahy019090 268 AIAEAMKDEDRVHIIDFQISQGSQWITLIQAFAARPGGPPHIRITGIDDSTSAyaRGGGLHIVGKRLSKLAEHFKVPFEFHA-AAISGCDVQLHNLGVRP 366
                *************************************************998899999************************.88899************ PP

       GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                gEalaVn++++lh+++desvs+ ++rd++L+lvkslsPkvv++veqe+++n++ F+ rfle+++yy+a+f+s++++lpre++eri+vE+++l+r++vn++
  Ahy019090 367 GEALAVNFAFMLHHMPDESVSTLNHRDRLLRLVKSLSPKVVTLVEQESNTNTAAFFPRFLETMDYYTAMFESIDVTLPREHKERINVEQHCLARDLVNII 466
                **************************************************************************************************** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                aceg er+erhe l+kWr+r+ +aGF+p+pls+ ++ ++k ll +++++ yr+ee++g+l+lgW++r Lv+ +aW+
  Ahy019090 467 ACEGVERVERHEVLGKWRSRFAMAGFSPYPLSSLVNGTIKKLLDNYSDR-YRLEERDGALYLGWMNRDLVASCAWK 541
                ***********************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098570.028145522IPR005202Transcription factor GRAS
PfamPF035148.2E-137171541IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
MQASEHHRSS SMYYQPMQQV EAYCMPQYQA LNHHQYYNDG GHGIGSRFSN QSSSEIYCTL  60
ESSSATGSFN VYNSPSTVSF SPNGSPVSLQ DSQSQSYPPD NNYGSPMSGS CITDDLSTFK  120
HKLRELESVM FGPDCDNLDS YDSSFKDATD FMSSEMDSWR QTMVAISCKN LKHVLVVCAK  180
AIAENDLLMA QRLMDELRQM VSVSGEPIQR LGAYMLEGLV ARLSSSGSSI YRALRCKEPE  240
SAELLSYMHI LYEVCPYFKF GYMSANGAIA EAMKDEDRVH IIDFQISQGS QWITLIQAFA  300
ARPGGPPHIR ITGIDDSTSA YARGGGLHIV GKRLSKLAEH FKVPFEFHAA AISGCDVQLH  360
NLGVRPGEAL AVNFAFMLHH MPDESVSTLN HRDRLLRLVK SLSPKVVTLV EQESNTNTAA  420
FFPRFLETMD YYTAMFESID VTLPREHKER INVEQHCLAR DLVNIIACEG VERVERHEVL  480
GKWRSRFAMA GFSPYPLSSL VNGTIKKLLD NYSDRYRLEE RDGALYLGWM NRDLVASCAW  540
K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-591755418375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016166585.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLV7BDE60.0V7BDE6_PHAVU; Uncharacterized protein
STRINGGLYMA14G01020.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein